Human PRSS1 protein

Catalog Number: orb604330

Catalog Number	orb604330
Category	Proteins
Description	Recombinant Human Trypsin-1(PRSS1)
Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 85% as determined by SDS-PAGE.
MW	31.6 kDa
UniProt ID	P07477
Protein Sequence	IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Protein Length	Full Length of Mature Protein
Source	E.coli
Expression System	Expression Region: 24-247aa. Protein Length: Full Length of Mature Protein
Expression Region	24-247aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Beta-trypsin (Cationic trypsinogen) (Serine protea Read more...
Note	For research use only
Application notes	Full Length of Mature Protein
Expiration Date	6 months from date of receipt.

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	42.1 kDa
Source:	E.coli

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human PRSS1(Ala16-Ser247) was fused with the C-terminal His and Fc Tag and expressed in Mammalian cells.