Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human LIPA protein
Catalog Number orb418736
ReactivityHuman
ConjugationUnconjugated
Tested applicationsSDS-PAGE
Target LIPA
Product Properties
Form/Appearance Lyophilized: Tris-based buffer, 50% glycerol
Storage Store at 6 months at -20°C to -80°C.
Note For research use only.
Protein Sequence SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ
Purity >90% as determined by SDS-PAGE.
MW 70 kDa
Source E.coli
Uniprot ID P38571
Product Description

Recombinant Human Lysosomal acid lipase/cholesteryl ester hydrolase

Application Notes
Application Notes Tag Info: N-terminal GST-tagged
Expression Region: 22-399aa
Sequence Info: Full Length of Isoform 3
Reviews
Write Your Own Review
You're reviewing:Human LIPA protein - orb418736
Your Rating