Human IL22 protein

• Catalog Number: orb594790
• Category: Proteins
• Description: Recombinant Human Interleukin-22(IL22),partial (Active)
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
• Protein Length: Partial
• UniProt ID: Q9GZX6
• MW: 16.9 kDa
• Application notes: Partial
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL-22 (E. Coli) at 2μg/ml can bind Recombinant Human IL-22RA2 (C-Fc), the ED50 of Recombinant Human IL-22RA2 (C-Fc) is 34.43 ng/ml.
• Expression Region: 34-179aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Interleukin-22;IL-22;Cytokine Zcyto18;IL-10-relate
• Research Area: Immunology & Inflammation
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.