You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594787 |
---|---|
Category | Proteins |
Description | Recombinant Human Interleukin-17A(IL17A) (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 15.26 kDa |
UniProt ID | Q16552 |
Protein Sequence | GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | 24-155aa |
Biological Activity | The ED50 as determined by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells is 1-7 ng/ml. |
Expression Region | 24-155aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20mM PB, 150mM NaCl, pH 7.4. |
Alternative names | Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lympho Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 95% as determined by SDS-PAGE. | |
15.9 kDa | |
Baculovirus |
Greater than 95% as determined by SDS-PAGE. | |
15.9kDa | |
Mammalian cell |
Biotin | |
95% | |
77.6 kDa | |
Biotinylated Human IL-17 RC, Fc, (orb1291791) is expressed from human 293 cells (HEK293). It contains AA Leu 21 - His 465 (Accession # Q8NAC3-2). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by RP-HPLC and reducing SDS-PAGE. | |
E. coli |
Filter by Rating