Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human IL 6 (CHO) protein
Catalog Number orb426531
ReactivityHuman
ConjugationUnconjugated
Target IL 6 (CHO)
Product Properties
Form/Appearance Sterile filtered colorless solution.
IL-6 is a sterile filtered (0.22μm) solution (0.22mg/ml) in 20mM Tris-HCl buffer pH 7.2.
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Note For research use only.
Protein Sequence VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >95.0% as determined by analysis by SDS-PAGE.
Source Chinese Hamster Ovarian Cells.
Activity ED50 < 1 ng/ml. The activity was determined by the dose dependent stimulation of the proliferation of human TF-1 cells (human erythroleukemic indicator cell line).
Product Description

Recombinant of human IL 6 (CHO) protein

Reviews
Write Your Own Review
You're reviewing:Human IL 6 (CHO) protein - orb426531
Your Rating