Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human HSP27 protein
Catalog Number orb55636
ReactivityHuman
ConjugationUnconjugated
Tested applicationsELISA, Functional Assay, SDS-PAGE, WB
Target HSP27
Alternative Names
Product Properties
Form/Appearance 20mM Tris/HCl pH7.5, 0.45M NaCl, 10% glycerol, 5mM DTT
Concentration 1.35 mg/ml
Storage Store at -20°C
Note For research use only.
Protein Sequence MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Purity Affinity Purified
MW 27 kDa
Source E. coli
Uniprot ID P04792
Entrez 3315
Product Description

Recombinant human HSP27 protein

Reviews
Write Your Own Review
You're reviewing:Human HSP27 protein - orb55636
Your Rating
We use cookies to provide you with a better service. Carry on browsing if you're happy with this, or find out how to manage cookies notification-close