Cart summary

You have no items in your shopping cart.

Human HPRT1 Protein

SKU: orb1477416
FeaturedFeatured Product

Description

This product spans the sequence region MHHHHHHKETWWETWWTEWSQPKKKRKVWEAALAEALAEALAEHLAEALAEALEALAAGGGGSGFLGPAPAPAPAPA+2-218aa. Purity: Greater than 85% as determined by SDS-PAGE.

Images & Validation

Application Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

SourceE.coli
Biological OriginHomo sapiens (Human)
TagN-terminal 6xHis-tagged
Molecular Weight32.8 kDa
Expression RegionMHHHHHHKETWWETWWTEWSQPKKKRKVWEAALAEALAEALAEHLAEALAEALEALAAGGGGSGFLGPAPAPAPAPA+2-218aa
Protein LengthFull Length of Mature Protein
Protein SequenceATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
PurityGreater than 85% as determined by SDS-PAGE.

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLiquid or Lyophilized powder
Buffer/PreservativesIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
DisclaimerFor research use only

Alternative Names

(HGPRT)(HGPRTase)

Similar Products

  • Human HPRT1 protein [orb704607]

    Greater than 90% as determined by SDS-PAGE.

    28.4 kDa

    E.coli

    20 μg, 100 μg, 1 mg
  • EIF3B Antibody [orb411705]

    IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl, 30 μl
  • HPRT1 Antibody [orb239977]

    ELISA,  IHC

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Human HPRT1 Protein [orb1477411]

    Greater than 85% as determined by SDS-PAGE.

    32.8 kDa

    E.coli

    20 μg, 100 μg, 1 mg
  • Human HPRT1 Protein [orb1477412]

    Greater than 85% as determined by SDS-PAGE.

    32.7 kDa

    E.coli

    20 μg, 100 μg, 1 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Human HPRT1 Protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Human HPRT1 Protein (orb1477416)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

20 μg
$ 280.00
100 μg
$ 460.00
1 mg
$ 1,720.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry