Human GDNF protein

• Catalog Number: orb244225
• Category: Proteins
• Description: Recombinant human Glial cell line-derived neurotrophic factor
• Tag: N-terminal 6xHis-SUMO-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 31.1 kDa
• UniProt ID: P39905
• Protein Sequence: SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
• Protein Length: Full Length of Mature Protein
• Source: E.coli
• Expression System: Expression Region: 78-211aa. Protein Length: Full Length of Mature Protein
• Expression Region: 78-211aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Alternative names: GDNF
• Note: For research use only
• Application notes: Full length of His-SUMO-tag and expression region is 78-211aa
• Expiration Date: 6 months from date of receipt.