You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human GDNF protein
Catalog Number: orb244225
| Catalog Number | orb244225 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Glial cell line-derived neurotrophic factor |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 31.1 kDa |
| UniProt ID | P39905 |
| Protein Sequence | SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 78-211aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | GDNF Read more... |
| Note | For research use only |
| Application notes | Full length of His-SUMO-tag and expression region is 78-211aa |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human GDNF Protein [orb1675340]
Unconjugated
90%
15.1 kDa
Human GDNF Protein, premium grade (orb1675340) is expressed from human 293 cells (HEK293). It contains AA Ser 78 - Ile 211 (Accession # P39905-1).
1 mg, 50 μg, 20 μg - Item 1 of 3
Recombinant human GFRAL protein, C-His-Avi (HEK293) [orb1516445]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 48-62 kDa based on Tris-Bis PAGE result.
50 μg - Item 1 of 1
- Item 1 of 1
Human C6orf144 protein [orb358708]
Greater than 90% as determined by SDS-PAGE.
53.8 kDa
E.coli
20 μg, 1 mg, 100 μg - Item 1 of 1
Human GDNF protein (Active) [orb359181]
> 97% as determined by SDS-PAGE and HPLC.
15.1 kDa
E.Coli
500 μg, 10 μg, 100 μg
