Human GDF6 protein

SKU: orb705306

Description

This Human GDF6 protein spans the amino acid sequence from region 336-455aa. Purity: > 95 % as determined by SDS-PAGE and HPLC analyses.

Research Area

Signal Transduction

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: E.Coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 2.0 μg/ml, corresponding to a specific activity of > 500 IU/mg.
• Tag: Tag-Free
• Molecular Weight: 13.6 kDa
• Expression Region: 336-455aa
• Protein Length: Full Length of Mature Protein
• Protein Sequence: TAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR
• Purity: > 95 % as determined by SDS-PAGE and HPLC analyses.
• Endotoxins: Less than 0.1 EU/µg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

BMP13, GDF16, GDF-6, BMP-13

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

Q6KF10