You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb358295 |
---|---|
Category | Proteins |
Description | Recombinant human FGL2 protein |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 49.6 kDa |
UniProt ID | Q14314 |
Protein Sequence | NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP |
Protein Length | Full Length of Mature Protein |
Source | Yeast |
Expression System | Expression Region: 24-439aa. Protein Length: Full Length of Mature Protein |
Expression Region | 24-439aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Fibrinogen-like protein 2 pT49 protein Read more... |
Note | For research use only |
Application notes | N-terminal 6xHis-tagged |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel
Unconjugated | |
90% | |
29.6 kDa | |
Human FGL2 (204-439) Protein, His Tag (orb1570937) is expressed from human 293 cells (HEK293). It contains AA Pro 204 - Pro 439 (Accession # Q14314-1). |
Unconjugated | |
90% | |
49.7 kDa | |
Human FGL2, His Tag (orb1570936) is expressed from human 293 cells (HEK293). It contains AA Asn 24 - Pro 439 (Accession # Q14314-1). |
Greater than 90% as determined by SDS-PAGE. | |
51.6 kDa | |
E.coli |
Filter by Rating