Human CTSS protein

Catalog Number: orb604010

Catalog Number	orb604010
Category	Proteins
Description	Recombinant Human Cathepsin S(CTSS)
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	28 kDa
UniProt ID	P25774
Protein Sequence	LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Protein Length	Full Length of Mature Protein
Source	E.coli
Expression System	Expression Region: 115-331aa. Protein Length: Full Length of Mature Protein
Expression Region	115-331aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Cathepsin S, CathepsinS, CATS_HUMAN, Ctss Read more...
Note	For research use only
Application notes	Full Length of Mature Protein
Expiration Date	6 months from date of receipt.

Purity:	> 95% by SDS-PAGE.
Source:	KMP1180, Recombinant Human Cathepsin S/CTSS Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Gln17-Ile331) of human Cathepsin S/CTSS (Accession #NP_004070.3) fused with an 8×His Tag at the C-terminus.

Sizes Available: 50 μg

Human CTSS protein [orb555692]
Source:
Human Cells
Sizes Available: 1 mg, 500 μg, 50 μg, 10 μg
Human CTSS Protein [orb424968]
Sizes Available: 1 mg, 20 μg, 5 μg

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Source:	Human cells

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human CTSS(Gln17-Ile331) was fused with the C-terminal His Tag and expressed in Mammalian cells.