You have no items in your shopping cart.
Human CD41 protein
SKU: orb246754
Featured
Description
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 29 kDa |
| Expression Region | 639-887aa |
| Protein Length | Partial |
| Protein Sequence | CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−Antigen CD41 protein, CD 41 protein, CD41 protein, CD-41 protein, CD41 antigen protein, CD41a protein, CD41b protein, GP2b protein, GPalpha IIb protein, GPalphaIIb protein, GPIIb protein, GT protein, Gta protein, HPA 3 protein, HPA3 protein, Integrin alpha 2b protein, Integrin alpha IIb protein, Integrin alpha IIb precursor protein, Integrin alpha-IIb light chain protein, ITGA 2B protein, ITGA2B protein, ITGAB protein, Platelet membrane glycoprotein IIb protein, Platelet specific antigen bak protein
Similar Products
−Human CD41 protein [orb246226]
Greater than 90% as determined by SDS-PAGE.
43 kDa
E.coli
20 μg, 1 mg, 100 μgRecombinant Human CD41/ITGA2B Protein, N-His [orb2969382]
>90% as determined by SDS-PAGE.
26.23 kDa
1 mg, 100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human CD41 protein (orb246754)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






