Human CD41 protein

Catalog Number: orb246754

Catalog Number	orb246754
Category	Proteins
Description	Human CD41 protein
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	29 kDa
UniProt ID	P08514
Protein Sequence	CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR
Protein Length	Partial
Source	Yeast
Expression System	Expression Region: 639-887aa. Protein Length: Partial
Expression Region	639-887aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Antigen CD41 protein, CD 41 protein, CD41 protein, Read more...
Note	For research use only
Application notes	This is His-tag protein
Expiration Date	6 months from date of receipt.

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	43 kDa
Source:	E.coli

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human ITGA2B(Met1-Arg993) was fused with the C-terminal His Tag and expressed in Mammalian cells.

Dynamic Range:	0.156-10ng/mL
Sensitivity:	0.1 ng/mL

Dynamic Range:	0.156-10ng/mL
Sensitivity:	< 0.055ng/mL

Dynamic Range:	0.156-10ng/mL
Sensitivity:	< 0.057ng/mL