Human CD41 protein

SKU: orb246754

Description

This Human CD41 protein spans the amino acid sequence from region 639-887aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

• Application Notes:
  This is His-tag protein

Key Properties

• Source: Yeast
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 6xHis-tagged
• Expression Region: 639-887aa
• Protein Length: Partial
• MW: 29 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Antigen CD41 protein, CD 41 protein, CD41 protein, CD-41 protein, CD41 antigen protein, CD41a protein, CD41b protein, GP2b protein, GPalpha IIb protein, GPalphaIIb protein, GPIIb protein, GT protein, Gta protein, HPA 3 protein, HPA3 protein, Integrin alpha 2b protein, Integrin alpha IIb protein, Integrin alpha IIb precursor protein, Integrin alpha-IIb light chain protein, ITGA 2B protein, ITGA2B protein, ITGAB protein, Platelet membrane glycoprotein IIb protein, Platelet specific antigen bak protein

Quick Database Links

UniProt

P08514