You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb603968 |
---|---|
Category | Proteins |
Description | Recombinant Human T-cell surface glycoprotein CD3 epsilon chain (CD3E),partial |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 15.8 kDa |
UniProt ID | P07766 |
Protein Sequence | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD |
Protein Length | Extracellular Domain |
Source | E.coli |
Expression System | Expression Region: 23-126aa. Protein Length: Extracellular Domain |
Expression Region | 23-126aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | T-cell surface antigen T3/Leu-4 epsilon chain (CD_ Read more... |
Note | For research use only |
Application notes | Extracellular Domain |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
39.2 kDa (CD3E) & 38.6 kDa (CD3G) | |
Human CD3E&CD3G Heterodimer Protein, Fc,His Tag&Fc,Flag Tag (orb348813) is expressed from human 293 cells (HEK293). It contains AA Asp 23 - Asp 126 (CD3E) & Gln 23 - Ser 116 (CD3G) (Accession # P07766-1 (CD3E) & P09693-1 (CD3G)). |
Unconjugated | |
90% | |
16.9 kDa | |
Human CD3 epsilon, His Tag (orb257326) is expressed from human 293 cells (HEK293). It contains AA Asp 23 - Asp 126 (Accession # P07766-1). |
Unconjugated | |
95% | |
39.2 kDa | |
Human CD3 epsilon, Fc,His Tag (orb257328) is expressed from human 293 cells (HEK293). It contains AA Asp 23 - Asp 126 (Accession # NP_000724.1). |
Greater than 90% as determined by SDS-PAGE. | |
47.7 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
13.8 kDa | |
Yeast |
Filter by Rating