HNF4A monoclonal antibody (M04), clone 4E2

• Catalog Number: orb2292796
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant HNF4A.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4E2
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: HNF4A (NP_000448, 324 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP
• NCBI: NP_000448
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged HNF4A is approximately 1 ng/ml as a capture antibody.

HNF4A monoclonal antibody (M04), clone 4E2 Western Blot analysis of HNF4A expression in HepG2.

HNF4A monoclonal antibody (M04), clone 4E2. Western Blot analysis of HNF4A expression in Jurkat.

Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of HNF4A expression in transfected 293T cell line by HNF4A monoclonal antibody (M04), clone 4E2. Lane 1: HNF4A transfected lysate (51.6 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of HNF4A over-expressed 293 cell line, cotransfected with HNF4A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HNF4A monoclonal antibody (M04), clone 4E2 (Cat # orb2292796). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).