Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $28.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name HMGB1 antibody
Catalog Number orb570317
Species/HostMouse
ReactivityHuman, Monkey, Mouse, Rat
ConjugationUnconjugated
Tested applicationsFACS, WB
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences.
Target HMGB1
Product Properties
Form/Appearance Lyophilized: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage Store at 4°C. Upon delivery aliquot and store at -20°C for one year. Avoid freeze/thaw cycles.
Note For research use only.
Reconstitution Add 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Isotype IgG2b
ClonalityMonoclonal
Purity Immunogen affinity purified.
Clone ID 5H3
Uniprot ID P09429
Entrez 3146
Product Description

Mouse monoclonal antibody to HMGB1

Application Notes
Dilution Range WB: 0.1-0.5 μg/ml, FACS: 1-3 μg/1x106 cells
Reviews
Write Your Own Review
You're reviewing:HMGB1 antibody - orb570317
Your Rating