You have no items in your shopping cart.
Cart summary
HIV-1 Integrase Protein
Catalog Number: orb81720
| Catalog Number | orb81720 |
|---|---|
| Category | Proteins |
| Description | Recombinant of HIV-1 Integrase protein |
| Form/Appearance | Sterile filtered colorless clear solution. |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
| Protein Sequence | MFLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDEDHHHHHH |
| Source | Escherichia Coli |
| Storage | Stability: HIV-1 Integrase although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles |
| Buffer/Preservatives | 1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X & 50% Glycerol. |
| Note | For research use only |
| Application notes | Applications: HIV-1 Integrase antigen is suitable for ELISA and Western blots, excellent antigen for early detection of HIV seroconvertors with minimal specificity problems |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
HIV-1 Integrase p31 Protein [orb81721]
Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
Escherichia Coli
1 mg, 100 μg, 0.5 mg
