HIV-1 Integrase Protein

• Catalog Number: orb81720
• Category: Proteins
• Description: Recombinant of HIV-1 Integrase protein
• Form/Appearance: Sterile filtered colorless clear solution.
• Buffer/Preservatives: 1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X & 50% Glycerol.
• Purity: Greater than 95.0% as determined by SDS-PAGE.
• Protein Sequence: MFLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDEDHHHHHH
• Application notes: Applications: HIV-1 Integrase antigen is suitable for ELISA and Western blots, excellent antigen for early detection of HIV seroconvertors with minimal specificity problems
• Source: Escherichia Coli
• Storage: Stability: HIV-1 Integrase although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles
• Note: For research use only
• Expiration Date: 6 months from date of receipt.