GNAQ Antibody

• Catalog Number: orb316570
• Category: Antibodies
• Description: GNAQ Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Bovine
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ (102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 42142 MW
• UniProt ID: P50148
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Guanine nucleotide-binding protein G (q) subunit a
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A431 cells using anti-GNAQ antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of C1QBP using anti-C1QBP antibody.Lane 1:human placenta tissue; 2:human Jurkat cell; 3:rat brain tissue; 4:mouse brain tissue.

IF analysis of GNAQ using anti-GNAQ antibody. GNAQ was detected in immunocytochemical section of A431 cells.

IHC analysis of GNAQ using anti-GNAQ antibody. GNAQ was detected in a paraffin-embedded section of mouse testis tissue.

IHC analysis of GNAQ using anti-GNAQ antibody. GNAQ was detected in a paraffin-embedded section of rat ovary tissue.

IHC analysis of GNAQ using anti-GNAQ antibody. GNAQ was detected in a paraffin-embedded section of human prostatic cancer tissue.