You have no items in your shopping cart.
Cart summary
Glycoprotein hormones alpha chain Protein, Canine, Recombinant (His & Myc)
Catalog Number: orb1979423
| Catalog Number | orb1979423 |
|---|---|
| Category | Proteins |
| Description | Glycoprotein hormones alpha chain Protein, Canine, Recombinant (His & Myc) is expressed in E. coli. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| MW | 18.1 kDa (predicted) |
| UniProt ID | Q9XSW8 |
| Protein Sequence | FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS |
| Expression System | E. coli |
| Biological Origin | Canine |
| Biological Activity | Glycoprotein hormones alpha chain Protein, Canine, Recombinant (His & Myc) is expressed in E. coli. |
| Expression Region | 25-120 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
