GLUL monoclonal antibody (M02), clone 3B6

• Catalog Number: orb2292891
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GLUL.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3B6
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG1 Kappa
• Immunogen: GLUL (NP_002056, 274 a.a. ~ 373 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
• NCBI: NP_002056
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GLUL is approximately 0.03 ng/ml as a capture antibody.

GLUL monoclonal antibody (M02), clone 3B6 Western Blot analysis of GLUL expression in Jurkat.

GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in HepG2.

GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in PC-12.

GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in Raw 264.7.

Western Blot analysis of GLUL expression in transfected 293T cell line by GLUL monoclonal antibody (M02), clone 3B6. Lane 1: GLUL transfected lysate (42.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).