GCLC monoclonal antibody (M01), clone 3H1

• Catalog Number: orb2292900
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GCLC.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3H1
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG1 Kappa
• Immunogen: GCLC (NP_001489, 528 a.a. ~ 637 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN
• NCBI: NP_001489
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GCLC is approximately 0.03 ng/ml as a capture antibody.

GCLC monoclonal antibody (M01), clone 3H1 Western Blot analysis of GCLC expression in A-431.

GCLC monoclonal antibody (M01), clone 3H1. Western Blot analysis of GCLC expression in NIH/3T3.

GCLC monoclonal antibody (M01), clone 3H1. Western Blot analysis of GCLC expression in PC-12.

Immunofluorescence of monoclonal antibody to GCLC on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of GCLC expression in transfected 293T cell line by GCLC monoclonal antibody (M01), clone 3H1. Lane 1: GCLC transfected lysate (72.8 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).