You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1978526 |
---|---|
Category | Proteins |
Description | Hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. Forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production in the terminal step of glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels. G6PC Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 5.6 kDa and the accession number is P35575. |
Tag | C-6xHis |
Purity | 98.00% |
MW | 5.6 kDa (predicted) |
UniProt ID | P35575 |
Protein Sequence | QRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPS |
Expression System | P. pastoris (Yeast) |
Biological Origin | Human |
Biological Activity | Hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. Forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production in the terminal step of glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels. G6PC Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 5.6 kDa and the accession number is P35575. |
Expression Region | 82-117 aa |
Storage | -20°C |
Note | For research use only |
Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Expiration Date | 6 months from date of receipt. |
98.00% | |
17.1 kDa (predicted) |
98.00% | |
17.7 kDa (predicted); 21 kDa (reducing conditions) |