You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577062 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZNF312 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF312 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 50kDa |
Target | FEZF2 |
UniProt ID | Q8TBJ5 |
Protein Sequence | Synthetic peptide located within the following region: THNDKKPFTCATCGKGFCRNFDLKKHVRKLHDSVGPAAPSAKDLTRTVQS |
NCBI | NP_060478 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | FEZ, TOF, FEZL, FKSG36, ZFP312, ZNF312 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-ZNF312 Antibody Titration: 5.0 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate. FEZF2 is supported by BioGPS gene expression data to be expressed in HepG2.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Human, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |