FCRLA Rabbit Polyclonal Antibody

SKU: orb325548

Description

Rabbit polyclonal antibody to FCRLA

Research Area

Cell Biology, Pharmacology & Drug Discovery, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FCRLA
• Target: FCRLA
• Protein Sequence: Synthetic peptide located within the following region: PTLNPAPQKSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYH
• Molecular Weight: 41
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FCRL antibody, anti FCRLM1 antibody, anti FCRLX antibody, anti FCRLb antibody, anti FCRLc1 antibody, anti FCRLc2 antibody, anti FCRLd antibody, anti FCRLe antibody, anti FREB antibody, anti MGC4595 antibody, anti RP11-474I16.5 antibody, anti FCRX antibody, anti FCRL1 antibody

WB Suggested Anti-FCRLA Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Lung.

Quick Database Links

Gene Symbol

FCRLA

UniProt

Q7L513

RefSeq (Protein):NP_116127