You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330283 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FBXW2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FBXW2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 51kDa |
Target | FBXW2 |
UniProt ID | Q9UKT8 |
Protein Sequence | Synthetic peptide located within the following region: SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI |
NCBI | NP_036296 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FBW2 antibody, anti Fwd2 antibody, anti MGC11 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Fetal Heart tissue using FBXW2 antibody
Western blot analysis of Jurkat cell lysate tissue using FBXW2 antibody
Western blot analysis of human Fetal Lung tissue using FBXW2 antibody
Western blot analysis of human Fetal Liver tissue using FBXW2 antibody
ELISA, IHC, WB | |
Bovine, Canine, Human, Mouse, Porcine, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Bovine, Canine, Porcine | |
Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating