EpCAM Antibody

• Catalog Number: orb381061
• Category: Antibodies
• Description: EpCAM Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, FC, IF, IHC, WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by sixteen ami
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By Heat Immunofluorescence, 2.5μg/ml Flow Cytometry, 1-3μg/1x106cells ELISA , 0.1-0.5μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 34932 MW
• UniProt ID: P16422
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Epithelial cell adhesion molecule;Ep-CAM;Adenocarc
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A431 cells using anti-EPCAM antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of EPCAM using anti-EPCAM antibody.Lane 1:HELA cell; 2:A549 cell; 3:PANC-1 cell.

IF analysis of EPCAM using anti-EPCAM antibody.EPCAM was detected in paraffin-embedded section of human colon organoid tissue.

IHC analysis of EPCAM using anti-EPCAM antibody. EPCAM was detected in a paraffin-embedded section of human intestinal cancer tissue.

IHC analysis of EPCAM using anti-EPCAM antibody. EPCAM was detected in a paraffin-embedded section of human prostatic cancer tissue.