You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb581376 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to EME2 |
| Target | EME2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human EME2 |
| Protein Sequence | Synthetic peptide located within the following region: TTARPHLAVIGLDAYLWSRQHVSRGTQQPESPKVAGAEVAVSWPEVEEVR |
| UniProt ID | A4GXA9 |
| MW | 41 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | SLX2B, gs125 |
| Research Area | Molecular Biology |
| Note | For research use only |
| NCBI | NP_001244299 |

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 26 kDa.

Sample Type: MCF7 Whole cell lysates, Antibody dilution: 1.0 ug/ml.

Positive control (+): HepG2 (HG), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.
ICC, IF | |
Bovine, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Cy7 |
ICC, IF | |
Bovine, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Cy5.5 |
ICC, IF | |
Bovine, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
RBITC |
ICC, IF | |
Bovine, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
APC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review