EME2 Rabbit Polyclonal Antibody

• Catalog Number: orb581376
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EME2
• Target: EME2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human EME2
• Protein Sequence: Synthetic peptide located within the following region: TTARPHLAVIGLDAYLWSRQHVSRGTQQPESPKVAGAEVAVSWPEVEEVR
• UniProt ID: A4GXA9
• MW: 41 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SLX2B, gs125
• Research Area: Molecular Biology
• Note: For research use only
• NCBI: NP_001244299

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 26 kDa.

Sample Type: MCF7 Whole cell lysates, Antibody dilution: 1.0 ug/ml.

Positive control (+): HepG2 (HG), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.