You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
EME2 Rabbit Polyclonal Antibody
Catalog Number: orb581376
| Catalog Number | orb581376 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to EME2 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human EME2 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 41 kDa |
| Target | EME2 |
| UniProt ID | A4GXA9 |
| Protein Sequence | Synthetic peptide located within the following region: TTARPHLAVIGLDAYLWSRQHVSRGTQQPESPKVAGAEVAVSWPEVEEVR |
| NCBI | NP_001244299 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | SLX2B, gs125 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 26 kDa.
Sample Type: MCF7 Whole cell lysates, Antibody dilution: 1.0 ug/ml.
Positive control (+): HepG2 (HG), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
