You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585357 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EEF1E1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 19kDa |
Target | EEF1E1 |
UniProt ID | O43324 |
Protein Sequence | Synthetic peptide located within the following region: IPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRV |
NCBI | NP_004271 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | P18, AIMP3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Human OVCAR-3, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane.
WB Suggested Anti-EEF1E1 Antibody, Titration: 1.0 ug/ml, Positive Control: OVCAR-3 Whole Cell.
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |