Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1 to 3 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name E.coli cry1Fb protein
Catalog Number orb244790
ConjugationUnconjugated
Target cry1Fb
Alternative Names
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage Store at -20°C. for extended storage, conserve at -20°C or -80°C.
Note For research use only.
Protein Sequence VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE
Purity >90% as determined by SDS-PAGE.
MW 48.1 kDa
Source E. coli
Uniprot ID O66377
Product Description

Recombinant Pesticidal crystal protein cry1Fb

Application Notes
Application Notes This is GST-tag protein
Reviews
Write Your Own Review
You're reviewing:E.coli cry1Fb protein - orb244790
Your Rating