Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

DLL1 Rabbit Polyclonal Antibody

SKU: orb330489

Description

Rabbit polyclonal antibody to DLL1

Research Area

Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Rat
Predicted ReactivityBovine, Mouse, Porcine, Rabbit

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human DLL1
TargetDLL1
Protein SequenceSynthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
Molecular Weight78 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti DELTA1 antibody, anti Delta antibody, anti DL1 antibody

Similar Products

  • DLL1 Rabbit Polyclonal Antibody [orb654420]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • DLL1 Rabbit Polyclonal Antibody [orb1292532]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • DLL1 Rabbit Polyclonal Antibody [orb2951744]

    ELISA,  IHC,  WB

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • DLL1 Rabbit Polyclonal Antibody [orb666490]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
  • DLL1 Rabbit Polyclonal Antibody [orb608154]

    WB

    Bovine, Canine, Gallus, Human, Rabbit, Rat, Sheep

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

DLL1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.

DLL1 Rabbit Polyclonal Antibody

Anti-DLL1 antibody IHC of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

DLL1 Rabbit Polyclonal Antibody

Anti-DLL1 antibody IHC of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

DLL1 Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

DLL1 Rabbit Polyclonal Antibody

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

DLL1 Rabbit Polyclonal Antibody

Sample Type: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

DLL1 Rabbit Polyclonal Antibody

Positive control (+): Mouse spleen (M-SP), Negative control (-): Mouse intestine (M-IN), Antibody concentration: 1 ug/mL.

DLL1 Rabbit Polyclonal Antibody

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

DLL1 Rabbit Polyclonal Antibody

WB Suggested Anti-DLL1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005609

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

DLL1 Rabbit Polyclonal Antibody (orb330489)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry