CYP2C19 Rabbit Polyclonal Antibody

• Catalog Number: orb578224
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CYP2C19
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP2C19
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: CYP2C19
• UniProt ID: P33261
• Protein Sequence: Synthetic peptide located within the following region: QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD
• NCBI: NP_000760
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CPCJ, CYP2C, P450C2C, CYPIIC17, CYPIIC19, P450IIC1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. CYP2C19 is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-CYP2C19 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.