You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578224 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CYP2C19 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CYP2C19 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | CYP2C19 |
UniProt ID | P33261 |
Protein Sequence | Synthetic peptide located within the following region: QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD |
NCBI | NP_000760 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CPCJ, CYP2C, P450C2C, CYPIIC17, CYPIIC19, P450IIC1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. CYP2C19 is supported by BioGPS gene expression data to be expressed in 721_B.
WB Suggested Anti-CYP2C19 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.
IF, IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |