Cart summary

You have no items in your shopping cart.

CoV-2 Nucleocapsid Protein

SKU: orb753231

Description

Recombinant Coronavirus 2019 Nucleocapsid

Images & Validation

Application Notes
Viral Antigens- Sars Proteins

Key Properties

SourceEscherichia Coli
Protein SequenceMSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKED LKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGAN KDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSR SRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAA EASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFF GMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADE TQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
PurityCoV 2019 Nucleocapsid protein is >95% pure as determined SDS-PAGE.

Storage & Handling

StorageStability: CoV 2019 Nucleocapsid protein is shipped on ice packs. Upon arrival, Store at -20°C
Form/AppearanceSterile Filtered clear solution.
Buffer/PreservativesCoV 2019 protein solution is supplied in PBS and 25mM K2CO3.
DisclaimerFor research use only

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

CoV-2 Nucleocapsid Protein (orb753231)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

50 μg
$ 380.00
0.25 mg
$ 1,010.00
1 mg
$ 2,200.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry