You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573611 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CDK4 |
Target | CDK4 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
UniProt ID | P11802 |
MW | 34kDa |
Tested applications | IHC-P, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CMM3, PSK-J3 |
Note | For research use only |
NCBI | NP_000066 |
CDK4 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb573611 with 1:200 dilution. Western blot was performed using orb573611 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: CDK4 IP with orb573611 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.
Lanes: 1. 30 ug human HCT116 cell lysate, 2. 30 ug genotoxic treated human HCT116 cell lysate, 3. 30 ug genotoxic treated human HCT116 cell lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: CDK4.
Lanes: Lane 1: 30 ug untreated human HCT116 cell lysate, Lane 2-3: 30 ug genotoxic agent treated human HCT116 cell lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: CDK4, CDK4 is supported by BioGPS gene expression data to be expressed in HCT116.
Rabbit Anti-CDK4 antibody, Catalog Number: orb573611, Paraffin Embedded Tissue: Human Heart cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-CDK4 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Porcine | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |