Cart summary

You have no items in your shopping cart.

    CD40 Antibody - N-terminal region : HRP

    CD40 Antibody - N-terminal region : HRP

    Catalog Number: orb2122964

    DispatchUsually dispatched within 5-10 working days
    $ 632.00
    Catalog Numberorb2122964
    CategoryAntibodies
    DescriptionCD40 Antibody - N-terminal region : HRP
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CD40
    Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
    ConjugationHRP
    MW30kDa
    UniProt IDP25942
    Protein SequenceSynthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
    NCBINP_001241
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
    Alternative namesp50, Bp50, CDW40, TNFRSF5
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars