CALHM2 Peptide - C-terminal region

SKU: orb1997976

Description

Images & Validation

−

Key Properties

−

Molecular Weight	36 kDa
Protein Sequence	Synthetic peptide located within the following region: EELVTKFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLHKWAQGLTGNG

Storage & Handling

−

Storage	Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized powder
Disclaimer	For research use only

Alternative Names

−

Fam26b, RGD1308276

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

Q5RJQ8

RefSeq (Protein):NP_001008307

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_001008307

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols