You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291742 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant BCL7B. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 6D2 |
Tested applications | ELISA, IF, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | BCL7B (NP_001698, 124 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES |
NCBI | NP_001698 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western Blot detection against Immunogen (34.43 KDa).
BCL7B monoclonal antibody (M01), clone 6D2. Western Blot analysis of BCL7B expression in MCF-7.
Detection limit for recombinant GST tagged BCL7B is approximately 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to BCL7B on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of BCL7B expression in transfected 293T cell line by BCL7B monoclonal antibody (M01), clone 6D2. Lane 1: BCL7B transfected lysate (22 KDa). Lane 2: Non-transfected lysate.