Bcat1 Rabbit Polyclonal Antibody

• Catalog Number: orb579691
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Bcat1
• Target: Bcat1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Protein Sequence: Synthetic peptide located within the following region: ACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTI
• UniProt ID: Q8CBC8
• MW: 43 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BCAT, Eca3, BCATc, Bcat-, Eca39
• Note: For research use only
• NCBI: NP_001019639

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms containing the peptide sequence are present at 46 kDa 38 kDa, and 36 kDa.

WB Suggested Anti-Bcat1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Mouse Heart.