You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579691 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Bcat1 |
Target | Bcat1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Protein Sequence | Synthetic peptide located within the following region: ACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTI |
UniProt ID | Q8CBC8 |
MW | 43 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | BCAT, Eca3, BCATc, Bcat-, Eca39 |
Note | For research use only |
NCBI | NP_001019639 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms containing the peptide sequence are present at 46 kDa 38 kDa, and 36 kDa.
WB Suggested Anti-Bcat1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Mouse Heart.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Human, Porcine, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |