You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295591 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant BAG1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2D3 |
Tested applications | ELISA, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2a Kappa |
Immunogen | BAG1 (NP_004314, 241 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE |
NCBI | NP_004314 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In ascites fluid |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
BAG1 monoclonal antibody (M02A), clone 2D3 Western Blot analysis of BAG1 expression in HeLa.
BAG1 monoclonal antibody (M02A), clone 2D3. Western Blot analysis of BAG1 expression in Jurkat.
BAG1 monoclonal antibody (M02A), clone 2D3. Western Blot analysis of BAG1 expression in LNCaP.
Western Blot detection against Immunogen (37.29 KDa).