BAG1 monoclonal antibody (M01), clone 4E2

• Catalog Number: orb2295593
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BAG1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4E2
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a kappa
• Immunogen: BAG1 (NP_004314, 241 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE
• NCBI: NP_004314
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BAG1 monoclonal antibody (M01), clone 4E2 Western Blot analysis of BAG1 expression in HeLa.

Detection limit for recombinant GST tagged BAG1 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to BAG1 on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot detection against Immunogen (37.29 KDa).