ARHGDIB purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2295848
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human ARHGDIB protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse
• Immunogen: ARHGDIB (NP_001166.3, 1 a.a. ~ 201 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
• NCBI: NP_001166.3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ARHGDIB MaxPab rabbit polyclonal antibody. Western Blot analysis of ARHGDIB expression in Jurkat.

ARHGDIB MaxPab rabbit polyclonal antibody. Western Blot analysis of ARHGDIB expression in mouse spleen.

Western Blot analysis of ARHGDIB expression in transfected 293T cell line by ARHGDIB MaxPab polyclonal antibody. Lane 1: ARHGDIB transfected lysate(23.00 KDa). Lane 2: Non-transfected lysate.