You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295847 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant ARHGDIB. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2C12-B6 |
Tested applications | ELISA |
Reactivity | Human |
Isotype | IgG1 kappa |
Immunogen | ARHGDIB (AAH09200, 1 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE |
NCBI | AAH09200 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged ARHGDIB is approximately 3 ng/ml as a capture antibody.