ANXA4 Rabbit Polyclonal Antibody

• Catalog Number: orb576071
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ANXA4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Zebrafish
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA4
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36 kDa
• Target: ANXA4
• UniProt ID: Q6LES2
• Protein Sequence: Synthetic peptide located within the following region: GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ
• NCBI: NP_001144
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ANX4, P32.5, PIG28, PP4-X, ZAP36, PAP-II, HEL-S-27
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein can be modified by acetylation and phosphorylation.

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Positive control (+): Human stomach (ST), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Human Intestine

WB Suggested Anti-ANXA4 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Placenta.