You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb379725 |
---|---|
Category | Antibodies |
Description | Goat polyclonal antibody to ATXN3. This protein appears to be a component of the ubiquitin proteasome system and has deubiquitinase activity. It may also have roles in neuroprotection, protein homeostasis maintenance, transcriptional and cytoskeleton regulation, myogenesis and degradation of misfolded chaperone substrates. The protein contains Qn repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease also known as spinocerebellar ataxia-3, an autosomal dominant neurologic disorder. |
Species/Host | Goat |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
Isotype | IgG |
Immunogen | Antigen: Purified recombinant peptide derived from within residues 120 aa to 250 aa of human ATXN3 produced in E. coli.. Antigen Sequence: KEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQMHRPKLIGEELAQLKEQRVHKTDLERVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADL |
Antibody Type | Primary Antibody |
Concentration | 1 mg/ml |
Dilution range | WB:1:250-1:2,000 |
Conjugation | Unconjugated |
Target | Ataxin 3 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | PBS; no preservatives; glycerol and azide FREE |
Alternative names | AT3, ATX3, ataxin-3, ataxin 3 variant h, autosomal Read more... |
Note | For research use only |
Application notes | The antibody solution should be gently mixed before use. |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human recombinant protein using ATXN3 antibody
WB | |
Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep | |
Goat | |
Polyclonal | |
Unconjugated |