Cart summary

You have no items in your shopping cart.

ADSSL1 Rabbit Polyclonal Antibody (Biotin)

ADSSL1 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2114386

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2114386
CategoryAntibodies
DescriptionADSSL1 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ADSSL1
Protein SequenceSynthetic peptide located within the following region: VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFS
UniProt IDQ8N142
MW50kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesMPD5, ADSSL1
NoteFor research use only
NCBINP_689541