Cart summary

You have no items in your shopping cart.

ADGB Rabbit Polyclonal Antibody (FITC)

ADGB Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2087784

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2087784
CategoryAntibodies
DescriptionADGB Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Human, Porcine
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human ADGB
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW67kDa
UniProt IDQ8N7X0
Protein SequenceSynthetic peptide located within the following region: SESGGVSSPGKEEREQSTRKENIQTGPRTRSPTILETSPRLIRKALEFMD
NCBINP_078970
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesCAPN16, C6orf103
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.