A2M monoclonal antibody (M03), clone 2B5

• Catalog Number: orb2296544
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant A2M.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2B5
• Tested applications: ELISA, PLA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: A2M (NP_000005.2, 641 a.a. ~ 730 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET
• NCBI: NP_000005.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged A2M is 3 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between IL1B and A2M. HeLa cells were stained with anti-IL1B rabbit purified polyclonal 1:1200 and anti-A2M mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (35.64 KDa).