RECENTLY VIEWED
Compare Products

You have no items to compare.

 

You're currently on:

p16 INK antibody

Datasheet
SizePriceAvailabilityQty
20 μl
$258
Usually dispatched within 5-10 working days
50 μl
$308
Usually dispatched within 5-10 working days
100 μl
$359
Usually dispatched within 5-10 working days
Shipping charges : Freight/Packing: $34

Rabbit polyclonal antibody to p16 INK

Product Information

Category Primary antibodies
Product name p16 INK antibody
Catalog Number orb224525
Host Rabbit
Clonality Polyclonal
Tested applications WB, IHC-P
Dilution range WB: 1:500-3000
Concentration 1 mg/ml
Reacts with Human, Mouse
UniProt ID P42771
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human p16 INK
Purity Affinity-chromatography
MW 16 kDa
Isotype IgG
Form PBS, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol
Specificity p16 INK antibody detects endogenous levels of total p16 INK
Storage Store at 4°C for short term and at -20°C for long term storage
Sequence MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Note For research use only.
Target p16 INK
Alternative names
anti ARF antibody, anti CD2A1 antibody, anti CDK4 inhibitor p16-INK4 antibody, anti CDK4I antibody, anti CDKN2 antibody, anti CDKN2A antibody, anti cell cycle negative regulator beta antibody, anti CMM2 antibody, anti Cyclin-dependent kinase 4 inhibitor A antibody, anti cyclin-dependent kinase inhibitor 2A (melanoma antibody, anti p16 antibody, anti inhibits CDK4) antibody, anti cyclin-dependent kinase inhibitor 2A antibody, anti isoform antibody

p16 INK antibody Documents

No document downloads available for this product

p16 INK antibody Related Products

NamePrice 
No related items to display

p16 INK antibody Customer Reviews

This product has not yet been reviewed. Be the first by entering your review below:


Write Your Own Review

How do you rate this product?*
1 star2 stars3 stars4 stars5 stars
 
Click image to enlarge
Western blot analysis of HeLa cell lysate using p16 INK antibody
Immunohistochemical staining of human prostate tissue using p16 INK antibody
 
 
We use cookies to provide you with a better service. Carry on browsing if you're happy with this, or find out how to manage cookies